PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013612385.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 292aa    MW: 31282.7 Da    PI: 6.6091
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013612385.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.67.9e-101155345
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45
                     +W+ e+d  + +a + +  +    W++Ia+ ++ g++ +q+k+++ 
   XP_013612385.1 11 AWSREDDIAFERALANHTDEseeKWEKIAADVP-GKSVEQIKEHYE 55
                     7*****************99*************.**********95 PP

2Myb_DNA-binding40.66e-13112156347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +W+++E+ l++ +  ++G+g+W++I+r +  +Rt+ q+ s+ qky
   XP_013612385.1 112 AWSEDEHRLFLLGLDKYGKGDWRSISRNFVVTRTPTQVASHAQKY 156
                      6*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512938.153762IPR017884SANT domain
SMARTSM007171.4E-8860IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-51155IPR009057Homeodomain-like
CDDcd001671.59E-81158No hitNo description
PfamPF002491.6E-81155IPR001005SANT/Myb domain
SuperFamilySSF466892.01E-91265IPR009057Homeodomain-like
PROSITE profilePS5129417.139104161IPR017930Myb domain
SuperFamilySSF466894.81E-16107162IPR009057Homeodomain-like
TIGRFAMsTIGR015579.0E-17109159IPR006447Myb domain, plants
SMARTSM007176.6E-10109159IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-10112155IPR009057Homeodomain-like
PfamPF002495.9E-11112156IPR001005SANT/Myb domain
CDDcd001671.72E-9112157No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MTVEEVSDGS AWSREDDIAF ERALANHTDE SEEKWEKIAA DVPGKSVEQI KEHYELLVED  60
VGRIESGCVP LPSYRSPPED AGDDGGSSKR GGNSHDQGSK AKADQERRKG IAWSEDEHRL  120
FLLGLDKYGK GDWRSISRNF VVTRTPTQVA SHAQKYFIRL NSMNKDRRRS SIHDITSVGD  180
VDVSTPQGPI TGQNNNNNNA GSAAVAGGGN KSAKQPASQP TPGPPMYGTP TIGQPVSGPL  240
VSAVGTPVNL PAPPHMAYGV HSAPVPGSVV PGAPMNMAQM PYTMPRTPTA HR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A5e-16976875RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0720901e-164AY072090.1 Arabidopsis thaliana unknown protein (At5g08520) mRNA, complete cds.
GenBankAY0965711e-164AY096571.1 Arabidopsis thaliana unknown protein (At5g08520) mRNA, complete cds.
GenBankAY5195321e-164AY519532.1 Arabidopsis thaliana MYB transcription factor (At5g08520) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013612385.10.0PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H79e-57DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0D3EGU30.0A0A0D3EGU3_BRAOL; Uncharacterized protein
STRINGBra009346.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM35562861
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.11e-145MYB family protein